CA Shivani Gupta

Search
Skip to content
  • Blog
    • Contact
    • Link in Bio
      • About
beauty, photography

World’s most beautiful and magical streets covered by flowers

February 25, 2015 CA Shivani Gupta 2 Comments

http:// http://www.boredpanda.com/tree-flower-shaded-streets/#post2

image

image

image

image

image

image

image

image

Share this:

  • Share on X (Opens in new window) X
  • Share on Facebook (Opens in new window) Facebook
  • Share on WhatsApp (Opens in new window) WhatsApp
  • Share on LinkedIn (Opens in new window) LinkedIn
  • Share on Tumblr (Opens in new window) Tumblr
  • Email a link to a friend (Opens in new window) Email
  • Print (Opens in new window) Print
  • Share on Reddit (Opens in new window) Reddit
  • Share on Pinterest (Opens in new window) Pinterest
  • Share on Telegram (Opens in new window) Telegram
Like Loading...

Related

flowersgkindshivanigreenerymagicalmost beautifulphotographyworld's

Post navigation

Previous PostGreen bathroomNext PostFlowers that look like something else

2 thoughts on “World’s most beautiful and magical streets covered by flowers”

  1. Kaleb S's avatar Kaleb S says:
    October 28, 2021 at 7:46 am

    Hi nice readingg your post

    LikeLike

    Reply
    1. CA Shivani Gupta's avatar Gkindshivani says:
      November 10, 2021 at 7:42 pm

      Thank you. 😊

      LikeLike

      Reply

Leave a comment Cancel reply

Follow CA Shivani Gupta on WordPress.com

Connect us

  • View gkindshivani.blog’s profile on Facebook
  • View @gkindshivani’s profile on Twitter
  • View cashivani’s profile on LinkedIn
  • View 112971503733777438728’s profile on Google+

Enter your E-mail to discover

Join 796 other subscribers

Recent Posts: elearnersclub

SUPER POWER MINDSET Launching Soon…10th April, 2022

SUPER POWER MINDSET Launching Soon…10th April, 2022

Originally posted on CA Shivani Gupta:
I am super excited to share the news with my community that my 1st book SUPER POWER MINDSET is ready to launch on 10th April, 2022, 8PM (IST) Are you all equally excited to pre-book your copies? I invite you all to the virtual launch of the book and…

L 784

L 784

“It doesn’t matter how fast or high you climb on the ladder if its leaning against the wrong wall.” ~ Steven R Covey

L783 Hindi Diwas

L783 Hindi Diwas

Essence of Pa-varga the fifth set of letters in the Sanskrit / Devnagri alphabet. Hindi is not just a language like others in the world. It has deeper connotations and one can gain knowledge of these only by gaining knowledge from our vedic scriptures. Letters Pa, Pha, Ba, Bha and Ma are the fifth set […]

L 782

L 782

REASONS WHY WE SHOULD CONSTANTLY READ BOOKS – 50 reasons to get motivation to read regularly. 1. Books help you to feel more confident. 2. Books help you to travel around the world in the cheapest way. 3. Books develop your personality. 4. Books provide food for thought. 5. Books make you laugh and think. […]

Recent Posts

  • “Unlock the Secret to Happiness: How ‘Magical Powers of Gratitude’ is Transforming Lives!”
  • SUPER POWER MINDSET – Now Amazon No1 Bestselling Book
  • We did it. We are Amazon No.1 bestseller within few hours of listing even before the official launch.
  • SUPER POWER MINDSET Launching Soon…10th April, 2022
  • Palindrome and Ambigram – Did you know?

Recent Comments

CA Shivani Gupta's avatarCA Shivani Gupta on Sunrise at Karang Beach, Sanur…
CA Shivani Gupta's avatarCA Shivani Gupta on Wind powered Kinetic Sculpture…
Black Sheep Town's avatarBlack Sheep Town on Wind powered Kinetic Sculpture…
Kishor Kumar's avatarKishor Kumar on Beautiful 3D Giraffe – o…
CA Shivani Gupta's avatarGkindshivani on Light Installations by Bruce M…

Archives

  • September 2024
  • April 2022
  • February 2022
  • December 2021
  • September 2021
  • September 2020
  • December 2019
  • January 2019
  • March 2018
  • September 2017
  • July 2017
  • March 2017
  • October 2016
  • September 2016
  • August 2016
  • July 2016
  • June 2016
  • April 2016
  • March 2016
  • February 2016
  • January 2016
  • December 2015
  • November 2015
  • October 2015
  • September 2015
  • August 2015
  • July 2015
  • June 2015
  • May 2015
  • April 2015
  • March 2015
  • February 2015
  • January 2015
  • December 2014
  • November 2014
  • October 2014
  • September 2014

It's All About Beautiful Life by Gkindshivani

Blog Stats

  • 278,202 hits

Gkindshivani.com

Gkindshivani.com

Recent Posts: Discover Indians

26 Biggest achievements of India till 26.1.22

26 Biggest achievements of India till 26.1.22

Here’s a list of 26 big achievements of India which has held every Indian’s head high with pride. What next would you like to add to the list?

Asia’s first All Women Aviation Firefighter Squad

Asia’s first All Women Aviation Firefighter Squad

India’s first squad of Women Firefighter is not just breaking the stereotypes but proving that there is nothing impossible that woman can’t do. First in its kind in Asia, meet this squad of 14 girls creating the history, proving there is nothing a woman cannot conquer and thus inspiring millions of young girls to chase […]

Recent Posts: Vocab Bank Blog

Convoluted

Convoluted

Meaning:  Intricately folded, twisted, or coiled (especially of an argument, story, or sentence) extremely complex and difficult to follow. Synonyms: Complicated, complex, involved, elaborate, serpentine, labyrinthine, tortuous, tangled, Byzantine. In Hindi: जटिल Use: When I fly, I prefer a direct flight not one which takes me on a convoluted journey. My head began to hurt as I […]

Atonal

Atonal

Meaning: Not written in any key or mode. Synonyms: Discordant, harsh, loud, strident, absonant, acute, blaring, dissonant, blatant, braying, brusque, cacophonous, gruff, squawking, stertorous, unharmonious, husky. In Hindi: अतान Use: I heard a new voice floating above the atonal music. The atmosphere was filled with an eerie, atonal melody.  

Categories

Goodreads

Spam Blocked

416,853 spam blocked by Akismet

Enter your email address to subscribe to this blog and receive notifications of new posts by email.

Join 796 other subscribers

Pages

  • Blog
    • Contact
    • Link in Bio
      • About

Social

Copyright Disclaimer

All images, unless otherwise noted, were taken from the Internet and are assumed to be in the public domain. In the event that there is still a problem or error with copyrighted material, the break of the copyright is unintentional and noncommercial and the material will be removed immediately upon presented proof.
Blog at WordPress.com.
Privacy & Cookies: This site uses cookies. By continuing to use this website, you agree to their use.
To find out more, including how to control cookies, see here: Cookie Policy
  • Comment
  • Reblog
  • Subscribe Subscribed
    • CA Shivani Gupta
    • Join 234 other subscribers
    • Already have a WordPress.com account? Log in now.
    • CA Shivani Gupta
    • Subscribe Subscribed
    • Sign up
    • Log in
    • Copy shortlink
    • Report this content
    • View post in Reader
    • Manage subscriptions
    • Collapse this bar
%d